- Recombinant Uncharacterized membrane protein yoyF (yoyF)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1225032
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 5,622 Da
- E Coli or Yeast
- 17168
- Uncharacterized membrane protein yoyF (yoyF)
Sequence
MIAKMMEALDGERFDIIMEKTLKGMTRVMIWGCLPYFLYVLIRMFTN